PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_12465_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 749aa    MW: 82833.4 Da    PI: 4.4882
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_12465_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.74.9e-12597638346
                                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                           rWT+++ el+++avkq+G++  + I + ++ gRt+ q+k+++ k
  cra_locus_12465_iso_5_len_2866_ver_3 597 RWTKQDTELFYEAVKQFGTD-LSMIQQLFP-GRTRRQVKLKYKK 638
                                           8*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159635.8E-27588669No hitNo description
PROSITE profilePS512939.482593641IPR017884SANT domain
SMARTSM007171.2E-8594642IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-6597638IPR009057Homeodomain-like
SuperFamilySSF466895.76E-11597644IPR009057Homeodomain-like
CDDcd001675.00E-8597638No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 749 aa     Download sequence    Send to blast
MDSAPFDDIF SDNAVKNARA GSKFQPRAKP RPPKKNSTTP STALSLQFQT TDSSVNTFTE  60
SCGVKDPSGL DGQGSSGIVN APSVDAGTTE NVNSTVGLDP GVSIFIPDSN EDWGSCFEKS  120
VGENGDIFIG LESFGDFLPD SSAVIDNSVP SSEAPAVDVP GSSNTEEGRI DPTVPAVDDS  180
ACFSDVPGIS SQPETSAAED PLTGPETIIS ASHGDDRDLD KEDLESYPCL ETLDISELAN  240
RSGRRIGKFQ PKPKSQLERH QTNISDLDLV HPVPTVSRQQ DSQLVPPEVN FVDHGLVTAS  300
TQNDILEFSS VGLSGPAAEI ASEAEESNPI EPSHAGAGIP GEHLESVPGK LTSRRAKTGK  360
SRKTVSDHLS PEHPTSNQTE TAGRVLRKRQ NNNNVYQLRD ESEDEVVADG DLPSSSPSVF  420
AAKGNKNDDQ EYQPENESLT KKVKKSKKTP GDKEKPVRKQ KKDNETSDQT AKAAPKKFLH  480
STRRRRVNKT LLETPEDEID FQKVPLRDLI LLAEHKERMA KKEATPSRAP PSNHSAGDFV  540
EPDNEDRGGD DFQQYYDEPF ASEQGGEAND KESSPRVQEN SEYFNYQTYM DKTPIARWTK  600
QDTELFYEAV KQFGTDLSMI QQLFPGRTRR QVKLKYKKEE RQHPLRLRDA LTNRARDHSH  660
FELVIDRLRQ LAAEEKQNSD KAESVDLTAE EEAEEEAPET SDKEGKSEQM DEEMMEKTEP  720
DYNKQVQSPV KTYDSEDDLL LWNQYKSEE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A068VEV10.0A0A068VEV1_COFCA; Uncharacterized protein